Protein Info for IAI47_07005 in Pantoea sp. MT58

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF13477: Glyco_trans_4_2" amino acids 2 to 139 (138 residues), 69.2 bits, see alignment E=9.2e-23 PF13439: Glyco_transf_4" amino acids 13 to 169 (157 residues), 28.9 bits, see alignment E=2.2e-10 PF00534: Glycos_transf_1" amino acids 182 to 340 (159 residues), 94.6 bits, see alignment E=1e-30 PF13692: Glyco_trans_1_4" amino acids 190 to 330 (141 residues), 73.6 bits, see alignment E=4e-24

Best Hits

KEGG orthology group: None (inferred from 43% identity to ecm:EcSMS35_2263)

Predicted SEED Role

"Lipid carrier : UDP-N-acetylgalactosaminyltransferase (EC 2.4.1.-) / Alpha-1,3-N-acetylgalactosamine transferase PglA (EC 2.4.1.-); Putative glycosyltransferase" in subsystem N-linked Glycosylation in Bacteria (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>IAI47_07005 glycosyltransferase family 4 protein (Pantoea sp. MT58)
MYFVNTDWYFELHWLDRVSKLVNDGYDVHLITCFNDELVKKRLQYIGIHCWHIEIDRFSI
NPFSNVINLISFFKLFNKIKPDLIHTITIKPNIIGGMVARFKSIPQIISVVGLGRVFLRE
NLLKKVATLLYRIVIYKNKRVQLIFEHESDKRVLENMVVIDSCNLHVIDGAGIDVEKFPY
TPEIQTESIKVLFASRLLKSKGLEILVESIRKLKAEGLDIILYVAGIVDEKDPDRISMQQ
IKEWQNEGLIEWLGTRNDVDALLKECNIMVLPTKYAEGIPRIILEACAIGRACIVGNMPG
CRSIIENRVNGMILAEHSVNELSNSLSLLSSNPDLRKAYGIISSEKIKNKFSKEVIISKT
VEVYNFAISNNLHD