Protein Info for IAI47_07000 in Pantoea sp. MT58

Annotation: UDP-glucose 4-epimerase GalE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 162 (162 residues), 46.1 bits, E=1.8e-15
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 2 to 334 (333 residues), 453.3 bits, E=2e-140
• PF00106: adh_short
  • amino acids 2 to 70 (69 residues), 30.5 bits, E=1.2e-10
• PF01370: Epimerase
  • amino acids 3 to 262 (260 residues), 206.1 bits, E=2.8e-64
• PF05368: NmrA
  • amino acids 3 to 124 (122 residues), 24.5 bits, E=8.5e-09
• PF08659: KR
  • amino acids 3 to 136 (134 residues), 33.7 bits, E=1.7e-11
• PF02719: Polysacc_synt_2
  • amino acids 3 to 183 (181 residues), 57.7 bits, E=5.5e-19
• PF16363: GDP_Man_Dehyd
  • amino acids 4 to 325 (322 residues), 193.5 bits, E=3.6e-60
• PF01073: 3Beta_HSD
  • amino acids 4 to 157 (154 residues), 65.7 bits, E=1.8e-21
• PF07993: NAD_binding_4
  • amino acids 5 to 165 (161 residues), 23 bits, E=2e-08
• PF13460: NAD_binding_10
  • amino acids 7 to 129 (123 residues), 28.2 bits, E=8.3e-10

Best Hits

Swiss-Prot: 80% identical to GALE_ERWAM: UDP-glucose 4-epimerase (galE) from Erwinia amylovora

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 99% identity to pva:Pvag_1972)

MetaCyc: 59% identical to UDP-glucose 4-epimerase (Escherichia coli K-12 substr. MG1655)
UDP-glucose 4-epimerase. [EC: 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• D-galactose degradation I (Leloir pathway) (5/5 steps found)
• D-galactose detoxification (3/3 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• stachyose degradation (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (11/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.2

Protein Sequence (337 amino acids)

>IAI47_07000 UDP-glucose 4-epimerase GalE (Pantoea sp. MT58)
MAILVTGGAGYIGSHTVLALLQRGDDVVVLDNLCNASREAINRVEKLAGKKATFVEGDIR
DRACLRDLFASNSISAVIHFAALKAVGESTRMPLEYYENNVAGTVVLLEEMRNAGVWNFI
FSSSATVYGADAPVPYVETTPIGGTTSPYGTSKLMTEFVMRDFAKAEPKFKAIALRYFNP
VGAHESGEIGEDPTGIPNNLLPYIAQVAIGRLEKLGVFGGDYDTPDGTCLRDYIHVVDLA
EGHLKALDHLNKVEGYTAFNLGGGKGFSVLEMIKAFEKASGKAIPFEIKPRRDGDLPAFW
ADASLANSTLDWRVTRGIDEMMRDTWNWQSKNPDGFE