Protein Info for IAI47_06990 in Pantoea sp. MT58

Annotation: lipopolysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 416 to 437 (22 residues), see Phobius details PF01943: Polysacc_synt" amino acids 7 to 272 (266 residues), 109.6 bits, see alignment E=2e-35 PF13440: Polysacc_synt_3" amino acids 29 to 320 (292 residues), 175 bits, see alignment E=2.2e-55

Best Hits

Swiss-Prot: 76% identical to AMSL_ERWAM: Amylovoran biosynthesis protein AmsL (amsL) from Erwinia amylovora

KEGG orthology group: K03328, polysaccharide transporter, PST family (inferred from 99% identity to pva:Pvag_1974)

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein WzxC" in subsystem Colanic acid biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>IAI47_06990 lipopolysaccharide biosynthesis protein (Pantoea sp. MT58)
MSGFKSQAIWLFGSTCFSAVLQVAQLSFLARKLETHELGLLAIINAILAVAGVLQDMGMS
SYLVHRQNITRREQSTIYWVNVSLSLCTGLIMLLIAFPVSWFYHLPELTGLIMLTSLNFL
VLGHLSQYQAHYIKTKRMVSLAKIEMGTKLFAFLCVVAMLEFTSLTVAAAILGLFINAFT
RILCMIALGEKSWRPTWEFDKATFIGAIRYGSYQLGSQTINQLRTQADALVVGKVMGAEM
LGVYSLAKELVLQPLKLVTPVINRLALPRFAEKQHDPEQLKKLFLKGTLGIMLFSSAMYL
VIGIFSPVIVRVLYGASHEQVYHLIPLMLLFGMLRPMGGLTGAISQANGRTNVEFYWNIV
ASIVVLAVLATTFIWPNVLYVALTLSISQILISALAHPFFIKPVIGIRFIPYARQWVAVS
VVFVGVMLLVNHFNLFVMPEWFEGWL