Protein Info for IAI47_06970 in Pantoea sp. MT58

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 79 to 98 (20 residues), see Phobius details PF20706: GT4-conflict" amino acids 169 to 275 (107 residues), 34.1 bits, see alignment E=2.3e-12 PF00534: Glycos_transf_1" amino acids 170 to 325 (156 residues), 128.8 bits, see alignment E=2.4e-41 PF13692: Glyco_trans_1_4" amino acids 174 to 313 (140 residues), 112.8 bits, see alignment E=2.3e-36

Best Hits

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_1978)

Predicted SEED Role

"putative LPS biosynthesis related glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>IAI47_06970 glycosyltransferase (Pantoea sp. MT58)
MKKIVLVIKDAYSYAGTENICNFMSECLGETHDVTIYSLEGSGKTFYPFEHVRQIVSFEG
QSNPIKSAVARIHEEGFDTVFLISMGRLSVMFAFWNLLAMKKKRGKAYACEHIAINSFSK
PIKFLKFLLLRYYDRVIVLTDKDHQVFSRWHIPSKQIPNPVVYKGFQRQTRHRQALAVGR
LDNQKGFDLMLDIWRDFARSHPDWTLVIAGDGELRQQLHDQAAVLGITDSVKFVGKVSNI
NDYYRDSDMALMTSRYEGLPLVLLEAKSWSLPVVAYDCPTGPQEIINHGEDGFLVPMNDK
ATFLARMEQLATDDALLFAMSDKTKQTALKFDGKQIKQSWLSLV