Protein Info for IAI47_06955 in Pantoea sp. MT58

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 38 to 56 (19 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details amino acids 255 to 277 (23 residues), see Phobius details amino acids 282 to 305 (24 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 33 to 364 (332 residues), 99.3 bits, see alignment E=1.2e-32

Best Hits

KEGG orthology group: None (inferred from 53% identity to ebi:EbC_29370)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>IAI47_06955 acyltransferase (Pantoea sp. MT58)
MYVLMMVLSLVIALMVLRLFSFHRGVYNGNGIKSISGLRALLASIVAFSHFAHYVYSLDH
EWIFDKDYFAWVSQGNFFANSGKFGVALFFMISAFLFYRWLDNDKLTTAELTRKLLKSRV
RRIVPMFWFSALLIVVIGWFSGDVVASGAMLVDGLRWFLFVGNYHIGSIPTANINAGVEW
TLRLEWLLYLSIPLIYLLNRATNGRFKMLFIMGSIGGILAVAIALRLWGTAYTDPRPVLG
FATGYLAWHYRDRFMALRTSGLAAVVAITLAVIALFFTSSTFYYLIFLCLLAVVFFVISS
GNSLFGLLESKTLMSVGEVSYSLYLIHGIVLYFIKKIPESLIQHNFFFYTLLSTLFFVAS
FYVARLTYLYVEKPFITSSQKKKEAANASSAI