Protein Info for IAI47_06945 in Pantoea sp. MT58

Annotation: EpsG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 128 to 136 (9 residues), see Phobius details amino acids 149 to 166 (18 residues), see Phobius details amino acids 172 to 198 (27 residues), see Phobius details amino acids 205 to 232 (28 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 287 to 309 (23 residues), see Phobius details amino acids 315 to 332 (18 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details PF14897: EpsG" amino acids 33 to 366 (334 residues), 104.9 bits, see alignment E=2.4e-34

Best Hits

KEGG orthology group: None (inferred from 76% identity to pam:PANA_2502)

Predicted SEED Role

"Amylovoran biosynthesis protein amsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>IAI47_06945 EpsG family protein (Pantoea sp. MT58)
MAPYWYVSGFLLLLSLFELALKKDERTSHILTYLLCIATVMLIVFGGIRGLGTGMDDYQY
RSFFEDFIRRIEVNGFLNTVAFFRYEPLIFAIAWITSLFSHNASAFLFVFSILAVGTNAI
FFKKMSPYPILALVLYSAHIFINKDVNQIRFGLSSAFFLGVVWTLYLKRYWLAFGFFILS
FISHNTAVMVVTLIPFLFIRERRWFPIAIIVLSIPASKVGGMGFVTAIAGHLGGLGERAA
GYNNDNAAGETGSVFSISNLKNVMLVFIFVYFMLTNQMKRDNYPAWRLNYLLVLTFAIGG
AIRIFFYNYPSGARLSNYLLQVEPIVLTLLIYQSKRVWKPAMFAMFIFFQVYYLYYNTIS
LKQAVMGYEVAREFKLIH