Protein Info for IAI47_06860 in Pantoea sp. MT58

Annotation: multidrug transporter subunit MdtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 393 to 418 (26 residues), see Phobius details amino acids 430 to 450 (21 residues), see Phobius details PF06779: MFS_4" amino acids 7 to 162 (156 residues), 31.8 bits, see alignment E=2e-11 PF05977: MFS_3" amino acids 12 to 171 (160 residues), 31.8 bits, see alignment E=1.1e-11 TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 15 to 431 (417 residues), 241.2 bits, see alignment E=1.1e-75 PF07690: MFS_1" amino acids 15 to 405 (391 residues), 171.1 bits, see alignment E=6.8e-54 amino acids 267 to 461 (195 residues), 45.7 bits, see alignment E=9e-16

Best Hits

Swiss-Prot: 74% identical to MDTD_ENT38: Putative multidrug resistance protein MdtD (mdtD) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 94% identity to pva:Pvag_1999)

Predicted SEED Role

"Multidrug transporter MdtD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>IAI47_06860 multidrug transporter subunit MdtD (Pantoea sp. MT58)
MTTQSTNVRWQLWIVAIGFFMQTLDTTIVNTAIPSMAHDLGVSPLHMHSVIVYYVLTVAV
MLPVSGWLADRFGVRNVFFCAILLFSIGSLLCAMSGTLDQLVLSRVVQGIGGAMMVPVGR
LTVMKIVPREQYMSAMTFVTLPGQIGPLLGPALGGVLVEYASWHWIFLINIPVGIAGAIA
TLMLMPNYSMQTRRFDFAGFILLAAGMATLTLALDGQRSSGGSPLLLGAMILVGLFSLLF
YLIHARGNDNALFSLKLFDNRVYAIGLLGSFTGRIGSGMLPFMTPIFLQIGMGYSPFHAG
LMMISMVLGNMGMKRLVVRIVNLYGYRNVLVMSTVALALVVLLFPLVALMGWVWLLPLVL
FLQGMVNAIRFSSMNTLTLKELPDELASSGNSLLSMIMQLSMSVGVTVAGLLLGAFAHEN
MANSTANHSMFIYTYLCMSLIILLPALVFWRVPPQTNANVDLRRRREK