Protein Info for IAI47_06835 in Pantoea sp. MT58

Annotation: D-galactonate dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF02746: MR_MLE_N" amino acids 11 to 110 (100 residues), 114.3 bits, see alignment E=3.9e-37 PF13378: MR_MLE_C" amino acids 192 to 379 (188 residues), 154.9 bits, see alignment E=2.7e-49

Best Hits

Swiss-Prot: 93% identical to MAND_PECCP: D-galactonate dehydratase family member PC1_0802 (PC1_0802) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K08323, starvation sensing protein RspA (inferred from 97% identity to pva:Pvag_2004)

Predicted SEED Role

"Starvation sensing protein RspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>IAI47_06835 D-galactonate dehydratase family protein (Pantoea sp. MT58)
MKIVKAEVFVTCAGRNFVTLKITTDQGLTGIGDATLNGRELPVASYLKDHICPQLIGRDA
HQIEDIWQYFYKGAYWRRGPVTMSAISAVDMALWDIKGKAANMPLYQLLGGASRTGVMVY
CHTTGHSIDEVMDDYAKHKELGFKAIRAQCGVPGMKTTYGMAKGKGLAYEPATKGHWPEE
QFWSTEKYLDFTPKLFAAIRDKFGFDEHLLHDMHHRLTPIEAARFGKSVEDYRLFWMEDP
TPAENQACFRLIRQHTVTPIAVGEVFNSIWDCKQLIEEQLIDYIRTTITHAGGITGMRRI
ADFASLYQVRTGSHGPSDLSPICMAAALHFDLWVPNFGVQEYMGFSEQMMELFDANWTFD
QGYMHPGDKPGLGIEFNEKLAAKYPYEPAYLPVARLEDGTLWNW