Protein Info for IAI47_06800 in Pantoea sp. MT58

Annotation: AEC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 167 to 191 (25 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 16 to 311 (296 residues), 99.1 bits, see alignment E=1e-32

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 97% identity to pva:Pvag_2012)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>IAI47_06800 AEC family transporter (Pantoea sp. MT58)
MPLLFESLSHQIYLSAPLFILILLGYCLTRLGKWPASISEGMNRFVFNVALPCMLFRVMS
TFSQSPPVDARLLLAFFGSCLLVFIVGRLLATRLFDLDGVAASVFALGGIFSNNVMLGIP
VATVLLGPEALPPVALVLVFNSLILWTLLTVSVEWAKQGSFSLNGLWRTLIGVLKNPLII
GILSGTAWSFLQRPLPLLAAEPLKMLASLAAPLSLVTLGMSLAHYRVRDGLKESYTICLL
KLVLQPMTVWAIAWLTGLPPLESKVVVLLGSMAVGVNVYLMSQKFNVITGPAAASMLFST
VFAAVTTPIWMMLMTLAGY