Protein Info for IAI47_06790 in Pantoea sp. MT58

Annotation: alkyl hydroperoxide reductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03137: peroxiredoxin
  • amino acids 1 to 187 (187 residues), 345.4 bits, E=3.9e-108
• PF00578: AhpC-TSA
  • amino acids 10 to 133 (124 residues), 122.5 bits, E=2e-39
• PF08534: Redoxin
  • amino acids 13 to 146 (134 residues), 43.8 bits, E=4.6e-15
• PF10417: 1-cysPrx_C
  • amino acids 155 to 182 (28 residues), 30.6 bits, 4.9e-11

Best Hits

Swiss-Prot: 90% identical to AHPC_SALTI: Alkyl hydroperoxide reductase C (ahpC) from Salmonella typhi

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 97% identity to pam:PANA_2529)

MetaCyc: 89% identical to alkyl hydroperoxide reductase, AhpC component (Escherichia coli K-12 substr. MG1655)
R4-RXN [EC: 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein C (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15, 1.6.4.-

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.26 or 1.6.4.-

Protein Sequence (187 amino acids)

>IAI47_06790 alkyl hydroperoxide reductase subunit C (Pantoea sp. MT58)
MSIINTKIKPFKNAAFKNGEFIDVTEKDVEGKWSVFFFYPADFTFVCPTELGDVADHYEE
FQKLGVDIYSVSTDTHFTHKAWHGSSDTIAKIKYTMIGDPTGALTRNFEIMREDEGLADR
GTFIVDPQGVIQAIEITAEGIGRDASDLLRKVKAAQYVASHPGEVCPAKWKEGDATLAPS
LDLVGKI