Protein Info for IAI47_06765 in Pantoea sp. MT58

Annotation: CidB/LrgB family autolysis modulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 49 (21 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details amino acids 204 to 228 (25 residues), see Phobius details TIGR00659: TIGR00659 family protein" amino acids 1 to 225 (225 residues), 314.1 bits, see alignment E=2.4e-98 PF04172: LrgB" amino acids 11 to 223 (213 residues), 257.8 bits, see alignment E=3.3e-81

Best Hits

Swiss-Prot: 73% identical to YOHK_SHIFL: Inner membrane protein YohK (yohK) from Shigella flexneri

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_2019)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>IAI47_06765 CidB/LrgB family autolysis modulator (Pantoea sp. MT58)
MSEIWWSLPLTLAAFFLARKLAIKLKISLLNPLLVAMAIIIPILLLLQLPYSRYFAGSEI
LNQLLQPAVVALALPLYEQMHQIRARWKSIIGVCFIGSVTAMSSGTAIALWMGATPEIAA
TIMPKSVTTPIAMAVSGSLHGIPAISAICVLIAGVLGAVFGHTVLNLLGVKSKAARGLAI
GNASHALGTARAAELDYQEGAFSSLALVICGIITSLLAPFIFPLLLHWFG