Protein Info for IAI47_06720 in Pantoea sp. MT58

Annotation: GTP cyclohydrolase I FolE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00063: GTP cyclohydrolase I
  • amino acids 40 to 220 (181 residues), 281.8 bits, E=9.5e-89
• PF01227: GTP_cyclohydroI
  • amino acids 41 to 218 (178 residues), 208.7 bits, E=2.5e-66

Best Hits

Swiss-Prot: 91% identical to GCH1_CITK8: GTP cyclohydrolase 1 (folE) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K01495, GTP cyclohydrolase I [EC: 3.5.4.16] (inferred from 99% identity to pva:Pvag_2029)

MetaCyc: 91% identical to GTP cyclohydrolase 1 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase I. [EC: 3.5.4.16]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 1" in subsystem Folate Biosynthesis or Molybdenum cofactor biosynthesis or Pterin biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• superpathway of chorismate metabolism (44/59 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)
• preQ₀ biosynthesis (3/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• tetrahydromonapterin biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16

Protein Sequence (221 amino acids)

>IAI47_06720 GTP cyclohydrolase I FolE (Pantoea sp. MT58)
MSTLSQEAALVHEALLARGLETPLRAPTRDIDDETRKSLIAGHMTEIMQLLNLDLEDDSL
METPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVIIDG
KATVAYIPKEKVIGLSKINRIVQFFAQRPQVQERLTQQVLVALQTLLGTNNVAVSIDAVH
YCVKARGVKDATSATTTTSLGGLFKSSQNTRQEFLRAVRHS