Protein Info for IAI47_06690 in Pantoea sp. MT58

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 267 to 291 (25 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details PF01032: FecCD" amino acids 39 to 353 (315 residues), 285.4 bits, see alignment E=2.4e-89

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to pva:Pvag_2035)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>IAI47_06690 iron ABC transporter permease (Pantoea sp. MT58)
MTTETSLLAGEETLHHTMQNYHQVLRRRLIWIGVLLVAIVASLILDFTLGPAGLSLDTLW
NTLLSPDSVDAGTRVIVWDIRLPYALMALVVGLSLGLAGAEMQTILNNPLASPFTLGVSS
AAAFGAALAIILGVGIPGIPDQWLISANAFVFALFAALMLDAVTRWTQVSSAGVVLFGIA
LVFTFNALVSMMQFIASEDTLQGLVFWTMGSLARASWEKLGVLTVALAILVPFSMMSSWK
LTALRLGEDRAVSFGIDVRRLRLTTLLRISILSALAVAFVGPIGFIGLVAPHIARMMFGE
DHRFYLPASALVGALVLSLASVASKNLLPGVIIPVGIVTSLIGVPFFLSIILRHRGTV