Protein Info for IAI47_06670 in Pantoea sp. MT58

Annotation: YeiH family putative sulfate export transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details TIGR00698: conserved hypothetical protein" amino acids 17 to 348 (332 residues), 412.6 bits, see alignment E=6.5e-128 PF03601: Cons_hypoth698" amino acids 18 to 327 (310 residues), 362.9 bits, see alignment E=5.6e-113

Best Hits

Swiss-Prot: 61% identical to YEIH_SALTI: UPF0324 inner membrane protein YeiH (yeiH) from Salmonella typhi

KEGG orthology group: None (inferred from 94% identity to pva:Pvag_2039)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>IAI47_06670 YeiH family putative sulfate export transporter (Pantoea sp. MT58)
MTELSIAKPHHPVTLWFPGLLLTAAIAAAASWLAQQPVVAAAGLGSLTLAIMLGILVGNS
VYTPLASRCDSGVILAKQKLLRLGIILFGFRITLQQIADVGFSGILIDALTLSSTFFITC
LLGIRLLKLDRDTVWLIGAGSSICGAAAVLATEPVVKAASSKVAVAIATVVLFGTLAIFI
YPMLWPLAHHLFPGLSASQFGVFTGSTIHEVAQVVAAGHSISPDAENSAVIAKMLRVMML
APFLLCLSAVLRGKRKARNARQPVTFPWFALLFIAVALFNSLQLLPATVVATLNELAGLL
LAMAMAALGLTTRFSALREAGVKPLLLGALVFGWLIAGGGTINLLVQHFMG