Protein Info for IAI47_06660 in Pantoea sp. MT58

Annotation: PTS fructose transporter subunit IIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 245 to 267 (23 residues), see Phobius details amino acids 276 to 301 (26 residues), see Phobius details amino acids 312 to 338 (27 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 390 to 411 (22 residues), see Phobius details amino acids 423 to 459 (37 residues), see Phobius details amino acids 472 to 491 (20 residues), see Phobius details amino acids 498 to 521 (24 residues), see Phobius details amino acids 528 to 560 (33 residues), see Phobius details PF02302: PTS_IIB" amino acids 115 to 204 (90 residues), 70.2 bits, see alignment E=2e-23 TIGR00829: PTS system, Fru family, IIB component" amino acids 115 to 198 (84 residues), 128.6 bits, see alignment E=8.9e-42 TIGR01427: PTS system, Fru family, IIC component" amino acids 224 to 561 (338 residues), 476.4 bits, see alignment E=6.4e-147 PF02378: PTS_EIIC" amino acids 242 to 505 (264 residues), 62.1 bits, see alignment E=5.1e-21

Best Hits

Swiss-Prot: 80% identical to PTFBC_ECOLI: PTS system fructose-specific EIIB'BC component (fruA) from Escherichia coli (strain K12)

KEGG orthology group: K02769, PTS system, fructose-specific IIB component [EC: 2.7.1.69] K02770, PTS system, fructose-specific IIC component (inferred from 96% identity to pva:Pvag_2041)

MetaCyc: 80% identical to fructose-specific PTS multiphosphoryl transfer protein FruA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>IAI47_06660 PTS fructose transporter subunit IIBC (Pantoea sp. MT58)
MKTLLIKDPTLGLASAYMAQQRLAAAAAAAGLTLTENPADAELAIVLGKNVPDDAALNGK
AVWLGDIQLAVREPETFLNRAKAEAKTWQAPAAVATPAGASVAAPAQAGAQKRVVAVTAC
PTGVAHTFMAAEAIQAEATRRGWWVKVETRGSVGAGNAITPEEVAAADLVIVAADIEVDL
AKFAGKPMYRTSTGLALKKTAQELDKAVAEAKPYKEVAGGQSNSSEEEKKGGAGAYRHLL
TGVSYMLPMVVAGGLSIALSFAFGITAFKEQGTLAAALMQIGGGSAFALMVPVLAGFIAF
SIADRPGLTPGLIGGMIATSINAGFLGGIIAGFIAGYAAKLISGKVKLPQSMEALKPILI
IPLFASLITGLLMIYVVGKPVAGIMSGLTHWLANMGTANAVLLGAILGGMMCTDMGGPVN
KVAYAFGVGLLSSQTYAPMAAIMAAGMVPPLAMGLATLVARRKFNKGQQEGGKAALVLGL
CFISEGAIPFAARDPMRVLPCCIVGGAITGAISMAIGAKLMAPHGGLFVLLIPGAITPVV
GYLMSIVIGTAVAGLGYAILKRPEEQLAKA