Protein Info for IAI47_06625 in Pantoea sp. MT58

Annotation: bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00877: NLPC_P60
  • amino acids 80 to 184 (105 residues), 118.4 bits, E=7e-39

Best Hits

Swiss-Prot: 72% identical to MEPS_ECO57: Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase (mepS) from Escherichia coli O157:H7

KEGG orthology group: K13694, lipoprotein Spr (inferred from 100% identity to pva:Pvag_2050)

MetaCyc: 72% identical to peptidoglycan endopeptidase/peptidoglycan L,D-carboxypeptidase (Escherichia coli K-12 substr. MG1655)
Muramoyltetrapeptide carboxypeptidase. [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]; 3.4.-.- [EC: 3.4.17.13]

Predicted SEED Role

"Lipoprotein spr precursor"

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)
• muropeptide degradation (4/4 steps found)
• peptidoglycan recycling II (7/10 steps found)
• peptidoglycan maturation (meso-diaminopimelate containing) (4/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.4.17.13

Use Curated BLAST to search for 3.4.17.13

Protein Sequence (191 amino acids)

>IAI47_06625 bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase (Pantoea sp. MT58)
MVKSQPILRYIMRIVPALALATLLSACSSTHSSQNANNENHEVNNHNGFLLQASQDEFEE
MVRNVDVKSRIMEQYAVWKGVRYRLGGDTKRGIDCSAFVQRTFRDQFGLELPRSTSEQQD
TGKEITRSKLRPGDLVMFRAGSTGRHVGIYLGNDNFVHASTSSGVMISSLNDDYWKKRYR
EGRRVLSRNPT