Protein Info for IAI47_06535 in Pantoea sp. MT58

Annotation: multidrug ABC transporter permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 54 to 77 (24 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 235 to 258 (24 residues), see Phobius details amino acids 265 to 290 (26 residues), see Phobius details TIGR01194: cyclic peptide transporter" amino acids 3 to 527 (525 residues), 363 bits, see alignment E=1.4e-112 PF00005: ABC_tran" amino acids 341 to 475 (135 residues), 98.2 bits, see alignment E=3.4e-32

Best Hits

Swiss-Prot: 70% identical to YOJI_ECOLI: ABC transporter ATP-binding/permease protein YojI (yojI) from Escherichia coli (strain K12)

KEGG orthology group: K06159, putative ATP-binding cassette transporter (inferred from 99% identity to pva:Pvag_2067)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>IAI47_06535 multidrug ABC transporter permease/ATP-binding protein (Pantoea sp. MT58)
MTLLSVVFRQFRWPFIGVIALTLLSAVLGIGMIAFINREMIVAINTSFAVLPQFLLQLVV
LMAVTLASQLALTMLGHQFVWRLRGEFIKRILDSRVERIEQLGSAQLLAGLTSDVRAITL
AFVRLPELFQGVIITLGSAIYLAWLSPKMLLVTSLWLGVTLVGGWMLVSRVYQHMAKLRE
IEDNLYRDYQTVIEGRKELQLNRSRAQQVYDTVYQEDARAWRHHIVRADTYHLSAVNWSN
IMTLGAIGMVFFMANSLGWANTAVAATFSLTLLFLRTPLLSAVGALPTLLSAQVAFRKLN
AFDLAPYQAGFHAPSASSDWQTLELRDVSFHYGDNGFQVGPINLTLRRGELVFLIGGNGS
GKSTLAMLLTGLYQPQSGTLLLDGKAITADELDVWRSQFSAVFTDLHLFDRLIGREGVAA
NPALVQQWLERLKMQDKLKIEGNKVLNLRLSKGQSKRLALLLAVAEERDVLLLDEWAADQ
DPHFRRIFYRELLPWLQQAGKTVFAISHDDHYFIHADRLLEMREGQLTELTGNERDLATL
DSVKRTDTGL