Protein Info for IAI47_06505 in Pantoea sp. MT58

Annotation: type I secretion system permease/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 714 transmembrane" amino acids 163 to 185 (23 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 269 to 291 (23 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details amino acids 412 to 436 (25 residues), see Phobius details TIGR03375: type I secretion system ATPase" amino acids 9 to 702 (694 residues), 845.3 bits, see alignment E=1.9e-258 PF00664: ABC_membrane" amino acids 165 to 427 (263 residues), 93.3 bits, see alignment E=2.2e-30 PF00005: ABC_tran" amino acids 497 to 642 (146 residues), 102 bits, see alignment E=4.4e-33

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 98% identity to pva:Pvag_2074)

Predicted SEED Role

"Type I secretion system ATPase, LssB family LapB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (714 amino acids)

>IAI47_06505 type I secretion system permease/ATPase (Pantoea sp. MT58)
MSTLTLNTDNWIAAMLRVAARFGKPADGKTLRQQMRWFEHLPVSQQLERLSGLLGLHLTM
VPQNKLRWRQEITPVVLVLENASVAVLENIDADGSARYWLSEGGDVVRESALSELLTRAQ
GDVGVIGVAARGRDARIDEFIQPYEPHWFWKNFRGMGRRITEISLASVIGNVLALAGILF
SMQVYDRVIPAQSQSTLWVLFVGVLIAAAIEYLIRLMRTQVSDLMGKRIDLKVSAMLFAR
AMSIRNEARPKSTGSFISQLREIDQVRELLTSTTVGAAADLPFVILFLFIMSFIGGWLVL
IPLAAIPLIVIPGLLVQIPMARLAKEGLREGALRNAVLVETIEGIEDIKALQAEPYFQRQ
WEQTHEVSAAISNQQRLWGARLTGWASTVQQLTYAGMLVFGVYLVLDSHITTGTLVACSL
LSSRTIAPLMQLTMVFSRWQHAKMAMKGLDELLKKPLDQPEAATLAHCPTLTGQYDLRNV
HYSYDEDNEKNVLNVQQLQIKPGEKIAILGKVGAGKSTLLKILAGQAQASQGKVIVDGVD
IERIDPTDLRRQLGWLSHDSRLFFGTLRQNLMLGNPHASEQEMLQALRISGALSLIQQDA
ASLDRIINEGGRGLSGGQRQMVMLSRLILRQPQVVLLDEPTAAMDEQLEEHVIRQLQGWI
SGRTLVLVTHRPALLKMVDRIVVMDNGRIVADGPRDEILRRATAPATAGKGDVA