Protein Info for IAI47_06500 in Pantoea sp. MT58

Annotation: TolC family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 44 to 440 (397 residues), 313 bits, see alignment E=1.7e-97 PF02321: OEP" amino acids 49 to 231 (183 residues), 101.6 bits, see alignment E=2.4e-33 amino acids 253 to 427 (175 residues), 71.2 bits, see alignment E=5e-24

Best Hits

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_2075)

Predicted SEED Role

"Agglutination protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>IAI47_06500 TolC family outer membrane protein (Pantoea sp. MT58)
MNKAQLTFLLCALSGVSVNAVFSAPLPKAEFNWRAAPTEEQIASLTLRDAILRAFARNPK
ISEAAAQIHVGEGDLDAARSAWYPQISLQGAAGRSHQTDSAGSLNNNGSGGITLSQLLYD
FGRTGSAIDEQHALSEAYRFGLFDSMTTVAEDTLQAYLEVKRYQALADIAHTNIASLQRV
RDIAKLRADAGLNSQSDVLQAETRIAAMQATLEQYRAQLRSATAQLTVLTGVVPATLPEL
PQALLKQQITLDKIAYESSAAVRSAQSKQEAARERVRQAQSGHWPTIKVQAGRTRYENDR
QSYWDDEVQLQVEAPLYQGGMVNAKTESAEGDREAAQAAVQQAKLAINQNASTAYADMIG
AQQRQAAGEVQLASADHTRNVYADEYRLSKRSLNDLLSVEQDVFQADSSRITALYDGWDA
TVRYAAAVDNLLDIMGIDRQQSSGDLLPSLQ