Protein Info for IAI47_06485 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 299 to 320 (22 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details PF07690: MFS_1" amino acids 24 to 322 (299 residues), 73.9 bits, see alignment E=6.1e-25

Best Hits

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_2081)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>IAI47_06485 MFS transporter (Pantoea sp. MT58)
MTALDASQQHKHQSRLNWGTRTIFLINGLGMSAWAPLVPFARDRLQLSGASLGALLLCLG
IGSLAAMPVTGTLVARFGCRRVMCVSTLLVLMMMPLLATADSHLVMAAALMLFGAGLGML
DVAMNYQAVQVEQAADKPMMSGFHGFFSLGGILGAGTVSLLLSRDFTPLTATLVVMAIML
LLLLWRLPVLMNARLHQPDQPWLVIPRGWVAFLGLLCFILFLAEGAVLDWGALLLLQNPA
MLPAYAGLGYAVFSVAMTLGRFSGDKIIQRFGRYPVMLSGALTAAAGMCLAVWLPWPEIA
LLAFLLVGFGLSNTVPMLFNAAGNQQDMPANLAISAMTTLGYAGILSGPALIGFISQWIS
LSGAFLLIALLLLAVAASARKVAR