Protein Info for IAI47_06425 in Pantoea sp. MT58

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF00583: Acetyltransf_1" amino acids 26 to 130 (105 residues), 31.8 bits, see alignment E=2.3e-11 PF13673: Acetyltransf_10" amino acids 46 to 149 (104 residues), 57.3 bits, see alignment E=2.4e-19 PF13508: Acetyltransf_7" amino acids 52 to 131 (80 residues), 31.2 bits, see alignment E=3.4e-11

Best Hits

Swiss-Prot: 56% identical to ELAA_ECOLI: Protein ElaA (elaA) from Escherichia coli (strain K12)

KEGG orthology group: K02348, ElaA protein (inferred from 86% identity to pva:Pvag_2093)

Predicted SEED Role

"ElaA protein" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>IAI47_06425 GNAT family N-acetyltransferase (Pantoea sp. MT58)
MNIDWQDKHHSELTAPELYALLALRSEVFVVEQQCAYLDVDGKDLQAENRHLLGTVDDQL
VAYARLLSPEDETSPVKIGRVIVSDRVRGARLGNRLMEQAISSCQQHWPGRDIFLSAQAH
LENFYGQHGFVAVGENYLEDGIPHVDMLKNAP