Protein Info for IAI47_06405 in Pantoea sp. MT58

Annotation: NADH-quinone oxidoreductase subunit NuoK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00420: Oxidored_q2
  • amino acids 8 to 100 (93 residues), 82.9 bits, E=5.9e-28

Best Hits

Swiss-Prot: 92% identical to NUOK_YERE8: NADH-quinone oxidoreductase subunit K (nuoK) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K00340, NADH dehydrogenase I subunit K [EC: 1.6.5.3] (inferred from 99% identity to pao:Pat9b_2722)

MetaCyc: 92% identical to NADH:quinone oxidoreductase subunit K (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to dimethyl sulfoxide electron transfer (2/2 steps found)
• nitrate reduction VIII (dissimilatory) (2/2 steps found)
• NAD(P)/NADPH interconversion (4/6 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NADH to fumarate electron transfer (1/2 steps found)
• NADH to hydrogen peroxide electron transfer (1/2 steps found)
• NADH to trimethylamine N-oxide electron transfer (1/2 steps found)
• aerobic respiration I (cytochrome c) (2/4 steps found)
• Fe(II) oxidation (1/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Protein Sequence (100 amino acids)

>IAI47_06405 NADH-quinone oxidoreductase subunit NuoK (Pantoea sp. MT58)
MIPLQHGLILAAVLFVLGLTSLVIRRNLLFMLIGLEIMINAAALALVVAGSYWGQADGQV
MYILAISLAAAEASIGLALLLQLYRRRQTLNIDTVSEMRG