Protein Info for IAI47_06290 in Pantoea sp. MT58

Annotation: histidine ABC transporter permease HisQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 15 to 37 (23 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 8 to 114 (107 residues), 68.4 bits, see alignment E=3.2e-23 PF00528: BPD_transp_1" amino acids 28 to 220 (193 residues), 93.1 bits, see alignment E=9.2e-31

Best Hits

Swiss-Prot: 84% identical to HISQ_SALTY: Histidine transport system permease protein HisQ (hisQ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10016, histidine transport system permease protein (inferred from 99% identity to pva:Pvag_2120)

MetaCyc: 36% identical to L-arginine ABC transporter membrane subunit ArtQ (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>IAI47_06290 histidine ABC transporter permease HisQ (Pantoea sp. MT58)
MLYGYSDVILRGTLVTLELALTSVVLAVLLGLIGAGAKLSRSRPLAMIFEGYTTLIRGVP
DLVLMLLIFYGLQIVLNQVTDALGMAQFDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
QGQIEAATAFGFTSAQVFRRILFPAMMRYALPGIGNNWQVILKATALVSLLGLEDVVKAT
QLAGKSTWQPFYFAIVAGVIYLVFTTLSNGVLWWLNRRYTVGVKRASYD