Protein Info for IAI47_06255 in Pantoea sp. MT58

Annotation: acetyl-CoA carboxylase, carboxyltransferase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00515: acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  • amino acids 1 to 283 (283 residues), 490.5 bits, E=8e-152
• PF17848: zf-ACC
  • amino acids 26 to 51 (26 residues), 51 bits, see alignment (E = 1.3e-17)
• PF01039: Carboxyl_trans
  • amino acids 93 to 242 (150 residues), 63.2 bits, E=1.9e-21

Best Hits

Swiss-Prot: 90% identical to ACCD_ERWT9: Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01963, acetyl-CoA carboxylase carboxyl transferase subunit beta [EC: 6.4.1.2] (inferred from 98% identity to pva:Pvag_2126)

MetaCyc: 91% identical to acetyl-CoA carboxyltransferase subunit beta (Escherichia coli K-12 substr. MG1655)
RXN0-5055 [EC: 2.1.3.15]

Predicted SEED Role

"Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.4.1.2)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
• superpathway of fatty acid biosynthesis initiation (5/5 steps found)
• biotin-carboxyl carrier protein assembly (4/4 steps found)
• fatty acid biosynthesis initiation (type II) (3/3 steps found)
• fatty acid biosynthesis initiation (type I) (1/3 steps found)
• propanoyl CoA degradation I (1/3 steps found)
• 2-oxobutanoate degradation I (1/4 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
• candicidin biosynthesis (1/6 steps found)
• 3-hydroxypropanoate cycle (6/13 steps found)
• jadomycin biosynthesis (3/9 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• methylaspartate cycle (9/19 steps found)
• superpathway of candicidin biosynthesis (3/11 steps found)
• superpathway of L-methionine salvage and degradation (5/16 steps found)
• superpathway of the 3-hydroxypropanoate cycle (6/18 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis
• Propanoate metabolism
• Pyruvate metabolism
• Tetracycline biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.2

Use Curated BLAST to search for 2.1.3.15 or 6.4.1.2

Protein Sequence (304 amino acids)

>IAI47_06255 acetyl-CoA carboxylase, carboxyltransferase subunit beta (Pantoea sp. MT58)
MSWIERILNKSTGTPVRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMHAR
ERLGSVLDQGTMVELGSELEPKDLLKFRDSKKYKDRLVAAQKDTGEKDALVVMKGQLHSM
PVVAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALQSLMQMA
KTSAALAKMRERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVR
EKLPPGFQRSEFLIEKGAIDMIIRRPEMRYKLASLLAKMMNLPAPLHDGEQSAPATTESE
SNEA