Protein Info for IAI47_06225 in Pantoea sp. MT58

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details PF00892: EamA" amino acids 7 to 135 (129 residues), 66.3 bits, see alignment E=1.6e-22 amino acids 150 to 280 (131 residues), 75.3 bits, see alignment E=2.7e-25

Best Hits

KEGG orthology group: None (inferred from 91% identity to pva:Pvag_2133)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>IAI47_06225 DMT family transporter (Pantoea sp. MT58)
MFFLYPLFAVIIWSINSIVSKLSASAIDPAAISFYRWLLALLVLTPFVLPGVWRARVAIK
PHLWRLAMLGLLGMVLYQSLAYYAAHSVSALFMGIIGALIPLLTVLLSVVILRIAPTLGI
LLGSIISFIGLVWLVSEGNVMQLLNHGLGKGELLMLAASAAYALYGVLTRRWALPLPIWQ
SLYVQILFGVVLLLPGFLLAPEVALNLHNLPLVAFAGLFASIIAPFLWIHGVQRLGASTT
SIFMNLIPVFTAMIAVIFLHEQLHSYHWIGGGLTLGGVILAQRLRTPLIRRKAVSLPPR