Protein Info for IAI47_06160 in Pantoea sp. MT58

Annotation: TSUP family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 160 to 176 (17 residues), see Phobius details amino acids 194 to 221 (28 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details PF01925: TauE" amino acids 14 to 249 (236 residues), 172.5 bits, see alignment E=6.3e-55

Best Hits

Swiss-Prot: 71% identical to YFCA_ECO57: Probable membrane transporter protein YfcA (yfcA) from Escherichia coli O157:H7

KEGG orthology group: K07090, (no description) (inferred from 96% identity to pva:Pvag_2141)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (267 amino acids)

>IAI47_06160 TSUP family transporter (Pantoea sp. MT58)
MDWFVVSPLLVGLLFLIAMLAGFIDSIAGGGGLLTVPSLLAAGLSPAQALATNKLQSVGG
SFSASLYFVRRGAVKLNEQWLNIAMTLMGSVLGAILIQRLQADFLRQMLPLFLIAIGLWF
LLMPRLGEVDQARRLHGLAYALVGGGAVGFYDGFFGPGAGSFYALAFVTLCGYNLAKATA
HAKVLNFTSNLGSLLFFMFGGKVVWGTGLVMMLGAFCGARLGARLVLSRGQKLIRPMVVI
VSAVMSIKLLWDSHGSDVLAWLATLHS