Protein Info for IAI47_06155 in Pantoea sp. MT58

Annotation: penicillin-insensitive murein endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF03411: Peptidase_M74" amino acids 36 to 270 (235 residues), 312.3 bits, see alignment E=1.2e-97

Best Hits

Swiss-Prot: 74% identical to MEPA_CITK8: Penicillin-insensitive murein endopeptidase (mepA) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K07261, penicillin-insensitive murein endopeptidase [EC: 3.4.24.-] (inferred from 97% identity to pva:Pvag_2142)

MetaCyc: 72% identical to peptidoglycan DD-endopeptidase/peptidoglycan LD-endopeptidase (Escherichia coli K-12 substr. MG1655)
3.4.-.-; 3.4.-.-

Predicted SEED Role

"Murein endopeptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>IAI47_06155 penicillin-insensitive murein endopeptidase (Pantoea sp. MT58)
MKALLLTLSALLISASSLAATPWQNIQHPISGAPQSIGGFANGCIVGAQSLPLNSPNYQV
MRQDQRRYFGHPDLIQFIQRLSTQVHNLQLGNVLIGDMGMAAGGRFSSGHASHQTGLDVD
IWLQLPKSRWSAQQLLKPQPLDLVGPGDKNVIARHWQPEIDSLIKLAAKDDDVTRIFVNP
AIKKQLCADAGNDRDWLRKVRPWFAHRAHMHVRLRCPAGSIGCEDQPAPPPGDGCGAELQ
SWFLPKQPGSGAPVKREPPPLPPACQALLDKHLL