Protein Info for IAI47_06110 in Pantoea sp. MT58

Annotation: phospholipid-binding lipoprotein MlaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF04333: MlaA" amino acids 32 to 225 (194 residues), 217.3 bits, see alignment E=8e-69

Best Hits

Swiss-Prot: 74% identical to MLAA_SHIFL: Intermembrane phospholipid transport system lipoprotein MlaA (mlaA) from Shigella flexneri

KEGG orthology group: K04754, lipoprotein (inferred from 98% identity to pva:Pvag_2152)

Predicted SEED Role

"Lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>IAI47_06110 phospholipid-binding lipoprotein MlaA (Pantoea sp. MT58)
MNYRLTSLAVASVLLVGCASSKPANSDPAGRSDPFEGFNRTMFNFNYNVLDPYVLRPVAV
AWRDYVPVPARTGLSNFLGNLEEPASMVNAILVGDGRDAGIHFTRFFLNSVLGLGGFIDV
AGKANPELAREEPHRFGTTLGHYGVGYGPYVELPAYGSFTVRQDGGDYVDTLYPILGWLT
WPMSIGKWTLEGIETRAQLLDSDAILKQQSDPYAFIRNAYFQRHDFLARGGKLKPEDNPN
AAAIQDDLKDIDAQ