Protein Info for IAI47_06100 in Pantoea sp. MT58
Annotation: cytochrome c-type biogenesis protein CcmH
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to CCMH_PSEAE: Cytochrome c-type biogenesis protein CcmH (ccmH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 97% identity to pva:Pvag_2154)Predicted SEED Role
"Cytochrome c heme lyase subunit CcmL" in subsystem Biogenesis of c-type cytochromes
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (150 amino acids)
>IAI47_06100 cytochrome c-type biogenesis protein CcmH (Pantoea sp. MT58) MRTLLLLCGLLFSINLWATIDTLQFDSVAQEEQYRDLTASLRCPKCQNNSIADSNAMIAA DMRLKVYELMKQGQSRQQIIDYMVARYGNFVSYSPPVTPSTLILWAGPALFALLGGAVII LRSRQRKTRSELDEDEQQRLNALLKSDRKP