Protein Info for IAI47_06085 in Pantoea sp. MT58

Annotation: cytochrome c maturation protein CcmE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03100: CcmE
  • amino acids 4 to 137 (134 residues), 144.7 bits, E=7.3e-47

Best Hits

Swiss-Prot: 73% identical to CCME_YERE8: Cytochrome c-type biogenesis protein CcmE (ccmE) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K02197, cytochrome c-type biogenesis protein CcmE (inferred from 94% identity to pva:Pvag_2157)

MetaCyc: 70% identical to periplasmic heme chaperone (Escherichia coli K-12 substr. MG1655)
RXN-21407

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmE, heme chaperone" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (9/11 steps found)

Protein Sequence (161 amino acids)

>IAI47_06085 cytochrome c maturation protein CcmE (Pantoea sp. MT58)
MNIRRRNRLYAALAILLGLGLATALVMYALRSNIDLFYTPGEILYGKGEAHEKPEAGQRL
RVGGMVMPGSVRRDPKTLAVSFKLYDARGVVSVSFEGILPDLFREGQGVVAQGVLAAGNQ
VIAKEVLAKHDEKYTPPEIENAMKSDQTGPQSRYQVGNKSS