Protein Info for IAI47_06065 in Pantoea sp. MT58

Annotation: cytochrome c biogenesis heme-transporting ATPase CcmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01189: heme ABC exporter, ATP-binding protein CcmA
  • amino acids 2 to 198 (197 residues), 267.5 bits, E=3.3e-84
• PF00005: ABC_tran
  • amino acids 18 to 154 (137 residues), 107.8 bits, E=7.3e-35

Best Hits

Swiss-Prot: 75% identical to CCMA_TATCI: Cytochrome c biogenesis ATP-binding export protein CcmA (ccmA) from Tatumella citrea

KEGG orthology group: K02193, heme exporter protein A [EC: 3.6.3.41] (inferred from 96% identity to pva:Pvag_2161)

MetaCyc: 57% identical to cytochrome c maturation protein A (Escherichia coli K-12 substr. MG1655)
RXN-21408

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, ATPase component CcmA" in subsystem Biogenesis of c-type cytochromes

MetaCyc Pathways

• cytochrome c biogenesis (system I type) (9/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.41

Protein Sequence (205 amino acids)

>IAI47_06065 cytochrome c biogenesis heme-transporting ATPase CcmA (Pantoea sp. MT58)
MLEIITLTCAYDERSLFRRLSFRVSAGDIVQIEGPNGAGKTSLLRLLAGLSRPEEGEIRW
QQQSILRQRESWHQAMLYLGHQPGVKGVLTPLENLRFYHPDCSNAQIFAALESVDLTGDE
EVPVSRLSAGQQRRVALARLWLSQARLWILDEPLTAIDKAGIEKLMAQFARHADNGGAVI
LTTHQDLPAEAARVRKIRLGDVEAE