Protein Info for IAI47_06060 in Pantoea sp. MT58

Annotation: formate/nitrite transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 57 to 79 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 134 to 157 (24 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 39 to 276 (238 residues), 163.1 bits, see alignment E=3.9e-52

Best Hits

Swiss-Prot: 74% identical to YFDC_ECOLI: Inner membrane protein YfdC (yfdC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_2162)

Predicted SEED Role

"putative transport"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>IAI47_06060 formate/nitrite transporter family protein (Pantoea sp. MT58)
MKPSSGNEQGPNDVESEEKDKGTDIEVDEEALPSRAAAIHEEIRQDGEKELERDGMALLW
SAIAAGLSMGASLMAKGIFKVHLDGVPGAFLLENLGYTFGFVIVIMARQQLFTENTVTAV
LPVMHKPTWGNTGLLLRLWSIVLLGNLIGTALGALAFNEMPIFDEATRQAFTDISMKVME
NTPGEMFANAVISGWIIATMVWMFPSAGGAKLLVIVMMTWLVALGDLAHIVVGSVEVLYL
VFNGSISWHEFLWPFALPTLLGNITGGTLIFALISHAQIRNDMSEAAVAKAKAEKRKQEK
RRQREEKENAE