Protein Info for IAI47_05905 in Pantoea sp. MT58

Annotation: PBSX family phage terminase large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF04466: Terminase_3" amino acids 21 to 211 (191 residues), 139.5 bits, see alignment E=1.1e-44 TIGR01547: phage terminase, large subunit, PBSX family" amino acids 23 to 387 (365 residues), 189.1 bits, see alignment E=8.5e-60 PF17288: Terminase_3C" amino acids 246 to 387 (142 residues), 61.2 bits, see alignment E=1.6e-20

Best Hits

KEGG orthology group: K06909, (no description) (inferred from 64% identity to plu:plu3406)

Predicted SEED Role

"Phage terminase, large subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>IAI47_05905 PBSX family phage terminase large subunit (Pantoea sp. MT58)
MTAAETRLSFAPKFKPLFQPKRYKTFHGGRGGAKSWAAARALVIMAASKKLRILCTREVQ
NSIKDSVHKLLKDQIEMLGLNPWFRITNESITSASGSEFLFKGLRFDPLGIKSTEGVDIC
WVEEAQSVSSDSWAILIPTIRKECSEIWVTFNPGEESDPTYQRFIVTPPDDSITVEVNYY
DNPYLPDTLRKEMEYCKRVDYEAYEHIWLGKPKSISDSVIFRNRYRVEAFPDDLWQQANR
LFFGADFGFANDPSTLIRMFMIDTRLYIEYEAYGVGVELDEMPQFYDSIPEVRKWPVKGD
NSRPETISYLARQGFSIDAAAKWKGSVEDGVTYLKGFEEIIIHERCKHTADEFRHYSYKV
DKKNGDILPIIVDKFNHCIDAIRYGLDGYITSSDSLGTWAQLGKG