Protein Info for IAI47_05705 in Pantoea sp. MT58

Annotation: DNA polymerase III subunit theta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06440: DNA_pol3_theta
  • amino acids 3 to 68 (66 residues), 106.5 bits, E=2.4e-35

Best Hits

Swiss-Prot: 52% identical to HOLE_ECOLI: DNA polymerase III subunit theta (holE) from Escherichia coli (strain K12)

KEGG orthology group: K02345, DNA polymerase III subunit theta [EC: 2.7.7.7] (inferred from 80% identity to pao:Pat9b_2159)

MetaCyc: 52% identical to DNA polymerase III subunit theta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III theta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Protein Sequence (80 amino acids)

>IAI47_05705 DNA polymerase III subunit theta (Pantoea sp. MT58)
MSHNLAARSREERDRINVDLAASGVAYKERMNQPVIPHEVEMQQPEAMREYFRERLQHYR
NVALQFPRGTDPVYFKEEGK