Protein Info for IAI47_05590 in Pantoea sp. MT58

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 532 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details amino acids 34 to 34 (1 residues), see Phobius details transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 112 to 136 (25 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 240 to 260 (21 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 314 to 337 (24 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 375 to 399 (25 residues), see Phobius details amino acids 412 to 429 (18 residues), see Phobius details amino acids 496 to 515 (20 residues), see Phobius details PF07690: MFS_1" amino acids 26 to 421 (396 residues), 82.8 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_2173)

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (532 amino acids)

>IAI47_05590 MFS transporter (Pantoea sp. MT58)
MNAKPATPPAPHPFTLRLALGLIGVLIAALTSGLNDRVSDIALADIRAAIGIGFDQGSWI
ISGYQAAEVAAMMIAPWFAVTLSLRRFTLGVSAGFMLTGILLPLVPDPTLFISLRVLQGL
FGGALPPMLMTVALRFLPPPFKLFGLAGYALTATFGPNMAASLASIWTDHVSWIMVFWQV
VPGMLIAMVLISWGIPQDPLRPERFQQIDLFGMVTGCIAVALLVLVLTQGERLDWLNSPL
IAGMLLAALPLLLVFLINEWFHPLPLFKLQMLRRPNLAHGLLGLACVLILGLSGSALPSA
YFAQVSGFRTLEFAPLALTVGLPQLLIAPLIAALLNIRWIDCRWMLTAGVGLLVTACLLG
SQITSDWARQNFWLLQILQAFGQPMIILPILMSATSVVAPPEGPFASAMFNTVRGFSSIA
ASTLVEVFLSHREQFHSSVLINQAASRSWLMTAPTADQASRSLPLLPDGSISASDNLSGF
ATLVRHQATILSLSDSWLMLTGFAACLLLLTAILPKRVWPPQTLIQHPPRNN