Protein Info for IAI47_05585 in Pantoea sp. MT58

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00529: CusB_dom_1" amino acids 22 to 335 (314 residues), 47.7 bits, see alignment E=3e-16 PF16576: HlyD_D23" amino acids 45 to 289 (245 residues), 70.5 bits, see alignment E=3.2e-23 PF13533: Biotin_lipoyl_2" amino acids 49 to 94 (46 residues), 56.5 bits, see alignment 4.7e-19 PF13437: HlyD_3" amino acids 213 to 301 (89 residues), 53.3 bits, see alignment E=9.9e-18

Best Hits

Swiss-Prot: 37% identical to EMRA_ACIBT: Colistin resistance protein EmrA (emrA) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 93% identity to pva:Pvag_2174)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>IAI47_05585 HlyD family secretion protein (Pantoea sp. MT58)
MRTFEMRRTLLLSLLLLVLLAIAFVVWTMMTSNDHRTNDAYVNADYTLVAPKVSGYISHV
EVQDNQQVKAGQLLATLDDRDYRVALESAEADLQVSQAKLLSSQAQLEQQQSMIDQQKAS
VAASQASAQYAGQSADRYNRLYKSGTVAADDQQKASSNQRSALAAVHQSQAALASAIKQV
GVLQAAVRSAEADVAAAKASVDQARLNLSYTRITAPVDGMVGQRAVRTGAYVSAGTRLLA
VVPLQQTYITANYLETQLSDVRPGQRVRIRVDALPGETFTGHVDSIAPATGATFSAIAPD
NATGNYTKVVQRLPVKIVLDGDQPHLAQLRVGMSAIPEIEAP