Protein Info for IAI47_05550 in Pantoea sp. MT58

Annotation: indolepyruvate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03393: indolepyruvate decarboxylase
  • amino acids 4 to 541 (538 residues), 1048.2 bits, E=0
• PF02776: TPP_enzyme_N
  • amino acids 5 to 109 (105 residues), 96.1 bits, E=1.9e-31
• PF00205: TPP_enzyme_M
  • amino acids 199 to 318 (120 residues), 57.5 bits, E=1.9e-19
• PF02775: TPP_enzyme_C
  • amino acids 389 to 519 (131 residues), 67.7 bits, E=1.5e-22

Best Hits

Swiss-Prot: 50% identical to KDC_MYCS2: Alpha-keto-acid decarboxylase (kdc) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K04103, indolepyruvate decarboxylase [EC: 4.1.1.74] (inferred from 90% identity to pva:Pvag_2180)

MetaCyc: 99% identical to indolepyruvate decarboxylase subunit (Pantoea agglomerans)
Indolepyruvate decarboxylase. [EC: 4.1.1.74]

Predicted SEED Role

"Pyruvate decarboxylase (EC 4.1.1.1); Alpha-keto-acid decarboxylase (EC 4.1.1.-)" (EC 4.1.1.-, EC 4.1.1.1)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (17/19 steps found)
• pyruvate fermentation to ethanol II (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• acetaldehyde biosynthesis II (1/1 steps found)
• L-methionine degradation III (2/3 steps found)
• indole-3-acetate biosynthesis VI (bacteria) (2/3 steps found)
• pyruvate fermentation to acetoin (2/3 steps found)
• pyruvate fermentation to acetate VIII (1/2 steps found)
• L-tryptophan degradation VIII (to tryptophol) (2/4 steps found)
• long chain fatty acid ester synthesis (engineered) (2/4 steps found)
• butanol and isobutanol biosynthesis (engineered) (4/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Glycolysis / Gluconeogenesis
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.1 or 4.1.1.74

Protein Sequence (550 amino acids)

>IAI47_05550 indolepyruvate decarboxylase (Pantoea sp. MT58)
MSTFTVGDYLLTRLQEIGIKHLFGVPGDYNLQFLDRVIAHPEISWVGCANELNAAYAADG
YARCNGAGALLTTFGVGELSAINGTAGSYAEYLPVIHIVGAPATQAQLQGDCVHHSLGDG
DFQHFIRMAAEVSVATALLNADNATAEIDRVIISALQARRPGYLSLAVDVAAMSVQPPAQ
PLNTHQPASADARRAFRAAAERLLAPAQRVSLLADFLALRWQQQSALAALREQSAIPCAS
LLMGKGVLDEQQPGYVGTYAGAASAGQVCEQIEQVDAAICVGVRFTDTITAGFTQQFATE
RLIDLQPFSASVGNERFAPLSMADALSELQPLFAHYGQQWQPAAAIPAAQPAEPTAVISQ
HAFWQAMQGFLQPGDLILAEQGTAAFGAAALRLPSRAQLVVQPLWGSIGYTLPAAFGAQT
ANPDRRVILIIGDGSAQLTIQELSSMLRDGQRLIIFLLNNDGYTVERAIHGATQRYNDIA
PWNWTALPHALSLQGQAQSWRISETVQLDEVMTRLAAPQWLSLVEVVMLKDDLPPLLRKV
TACLNQRNGG