Protein Info for IAI47_05535 in Pantoea sp. MT58

Annotation: Nramp family divalent metal transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 19 to 37 (19 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 239 to 263 (25 residues), see Phobius details amino acids 285 to 312 (28 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 19 to 377 (359 residues), 326.1 bits, see alignment E=1.9e-101 PF01566: Nramp" amino acids 38 to 379 (342 residues), 417.8 bits, see alignment E=1.8e-129

Best Hits

Swiss-Prot: 83% identical to MNTH_ERWT9: Divalent metal cation transporter MntH (mntH) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03322, manganese transport protein (inferred from 99% identity to pva:Pvag_2183)

MetaCyc: 80% identical to Mn2+/Fe2+: H+ symporter MntH (Escherichia coli K-12 substr. MG1655)
RXN0-2421; TRANS-RXN-241

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>IAI47_05535 Nramp family divalent metal transporter (Pantoea sp. MT58)
MLESRTAERAARGVRKVKLALLGPAFIAAIGYIDPGNFATNIQAGAAYGYKLLWVVVWAN
IMAMLIQLMSAKLGIATGKNLAEHIRDRFPRPAVWFYWVQAEIIAMATDLAEFIGAALGF
KLLLGISLMQSAVLTGIATFLILMLQSRGQKPLELVIGGLLLFVAAAYIVELFFSQPNIK
ELVVGMALPALPTSDAVFLAAGVLGATIMPHVIYLHSALTQGKSEDSKSQRYSSTKLDVA
IAMTIAGFVNLAMMATAAAAFHFSGHSKIAELDQAYLTLQPLLGQAAATVFGLSLVAAGL
SSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTMLPSFIVIWAGWDPTRVLVMSQVLLSFGI
ALALIPLLSFTGNRELMGDDMVNSRLMQNTGRLIVLLVIALNLYLLVGEALGL