Protein Info for IAI47_05515 in Pantoea sp. MT58

Annotation: formate/nitrite transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 188 to 216 (29 residues), see Phobius details amino acids 228 to 250 (23 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 8 to 248 (241 residues), 263.4 bits, see alignment E=8.8e-83

Best Hits

Swiss-Prot: 59% identical to YRHG_BACSU: Uncharacterized transporter YrhG (yrhG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to pva:Pvag_2187)

Predicted SEED Role

"Formate efflux transporter (TC 2.A.44 family)" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>IAI47_05515 formate/nitrite transporter family protein (Pantoea sp. MT58)
MSLHTPKEIAQLAIQSGVAKSRAPVSILLILGFMAGAFIATGFLLDLHVINSLPAEWGSF
GGLLGAAVFPVGIIMTVLAGGELLTGNMMTLPVAWFARRISFMSVARNWFWVTLANFIGS
VAVAWFFGHMLGMTEGDYLKKTVAIASAKVHADFLHSFISGIGCNWLVCLAVWLAFASKD
MVGKIFGMWFPVMAFVAIGFQHVVANMFIIPAAIFAGQMSWAEYFPNFVAVFLGNAVGGA
VFVGLAYFLAFRPAAEPASNPQ