Protein Info for IAI47_05505 in Pantoea sp. MT58

Annotation: glutamate--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 89% identical to SYE_ERWT9: Glutamate--tRNA ligase (gltX) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K01885, glutamyl-tRNA synthetase [EC: 6.1.1.17] (inferred from 99% identity to pva:Pvag_2189)

MetaCyc: 89% identical to glutamate--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Glutamate--tRNA ligase. [EC: 6.1.1.17]

Predicted SEED Role

"Glutamyl-tRNA synthetase (EC 6.1.1.17)" in subsystem Heme and Siroheme Biosynthesis or tRNA aminoacylation, Glu and Gln (EC 6.1.1.17)

MetaCyc Pathways

tRNA charging (21/21 steps found)
superpathway of heme b biosynthesis from glutamate (10/10 steps found)
tetrapyrrole biosynthesis I (from glutamate) (6/6 steps found)
(2S,3E)-2-amino-4-methoxy-but-3-enoate biosynthesis (2/10 steps found)
adenosylcobalamin biosynthesis II (aerobic) (13/33 steps found)
adenosylcobalamin biosynthesis I (anaerobic) (12/36 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>IAI47_05505 glutamate--tRNA ligase (Pantoea sp. MT58)
MKIKTRFAPSPTGYLHVGGARTALYSWLFARHNQGEFVLRIEDTDLERSTPEAIEAIMDG
MNWLSLDWNEGPYYQTKRFDRYNAVIDDMLEAGTAYKCYCSKERLEALREEQMANNEKPR
YDGHCRDSHEHHADDEPCVVRFRNPQEGSVIFDDQIRGPIEFSNQELDDLIIRRTDGSPT
YNFCVVVDDWDMGITHVIRGEDHINNTPRQINILKAIGAQVPVYAHVSMILGDDGKKLSK
RHGAVGVMQYRDDGYLPEALLNYLVRLGWSHGDQEIFSVAEMAELFTLDAVSKSASAFNT
EKLQWLNHHYINTLPPEYVATHLQWHIEEQKIDTRTGPELAKLVGLLGERCKTLKEMAAS
CRYFYEDFAEFDADAAKKHLRPVARQPLEVVRDKLAAITEWTAENVHQAIQSTADELEVG
MGKVGMPLRVAVTGAGQSPGLDVTVEAIGRSRSVARIEQALAFISEREAQA