Protein Info for IAI47_05465 in Pantoea sp. MT58

Annotation: bile acid:sodium symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details PF13593: SBF_like" amino acids 7 to 317 (311 residues), 359.7 bits, see alignment E=1.4e-111 PF01758: SBF" amino acids 41 to 216 (176 residues), 47.7 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 68% identical to YFEH_ECOLI: Putative symporter YfeH (yfeH) from Escherichia coli (strain K12)

KEGG orthology group: K14347, solute carrier family 10 (sodium/bile acid cotransporter), member 7 (inferred from 97% identity to pva:Pvag_2196)

Predicted SEED Role

"Putative cytochrome oxidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>IAI47_05465 bile acid:sodium symporter (Pantoea sp. MT58)
MGFLKLDPMMVKLIITVLLASFLPAKGIYVDVFSYLATAAIALLFFMHGAKLSREKIIAG
SSHWQLHLWIMFSTFVLFPALGLLLVWWHPVDVGPEIYTGFIYLCILPATVQSAIAFTSM
AGGNVAAAVCSASASSLLGVFISPLLVNLVMDIHSSAPSDGLEQIGKIMLQLMVPFILGH
LSRRWIGGWVEKHRSLIGKTDQTSILLVVYSAFSEAVVNGIWHRVGLTTLLWIVAGSIIL
LTAVLIINLLASRLFRFKRADEIVVLFCGSKKSLANGVPMANILFPASTVGIIVLPLMIF
HQVQLMVCSFIAGRYKKTNEKQQQQTLKVKDSVMESQK