Protein Info for IAI47_05375 in Pantoea sp. MT58

Annotation: DUF2919 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 111 (18 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details PF11143: DUF2919" amino acids 9 to 148 (140 residues), 144.4 bits, see alignment E=1.6e-46

Best Hits

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_2214)

Predicted SEED Role

"Inner membrane protein YfeZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>IAI47_05375 DUF2919 domain-containing protein (Pantoea sp. MT58)
MNTNPLPGYQPDEYDAKGQLRLPFLFWLILLLQARTWLLLAMAGASRQQGNGLLALFYPD
RQAFWIGLALGLPALAGLLLTGYRTRLPRLWQHWRSVLALSLLVNLLWQGWQFVQGDLLS
SPLPLLLTLFDLLALIWLQFNRRCRDCFLPEHHLN