Protein Info for IAI47_05195 in Pantoea sp. MT58

Annotation: DnaA inactivator Hda

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 TIGR03420: DnaA regulatory inactivator Hda" amino acids 8 to 233 (226 residues), 274.3 bits, see alignment E=3.9e-86 PF00308: Bac_DnaA" amino acids 18 to 214 (197 residues), 60.3 bits, see alignment E=1.3e-20

Best Hits

Swiss-Prot: 84% identical to HDA_YERPS: DnaA regulatory inactivator Hda (hda) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K10763, DnaA-homolog protein (inferred from 99% identity to pva:Pvag_2250)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>IAI47_05195 DnaA inactivator Hda (Pantoea sp. MT58)
MLLNTPAQLSLPLYLPDDETFSSFWPGENPSLIAALKGALNQQHGSYLYFWSREGGGRSH
LLHAACAEMSARSEAVGYVPLDKRTWFVPDVLEGMEQLSLVCIDNIECIAGEPEWEMAIF
DLYNRILETGNTRLFITGDRPPRQLNLQLPDLASRLDWGQIYRLQPLSDEDKLQALQLRA
GLRGFELPEDVGRFLLKRLDREMRTLFDTLDRLDRASISAQRKLTIPFVKETLGL