Protein Info for IAI47_05175 in Pantoea sp. MT58

Annotation: phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00639: phosphoribosylglycinamide formyltransferase
  • amino acids 2 to 192 (191 residues), 268.3 bits, E=1.5e-84
• PF00551: Formyl_trans_N
  • amino acids 2 to 182 (181 residues), 228.5 bits, E=2.6e-72

Best Hits

Swiss-Prot: 76% identical to PUR3_ECOLI: Phosphoribosylglycinamide formyltransferase (purN) from Escherichia coli (strain K12)

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 95% identity to pva:Pvag_2254)

MetaCyc: 76% identical to phosphoribosylglycinamide formyltransferase 1 (Escherichia coli K-12 substr. MG1655)
Phosphoribosylglycinamide formyltransferase. [EC: 2.1.2.2]

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.2

Protein Sequence (212 amino acids)

>IAI47_05175 phosphoribosylglycinamide formyltransferase (Pantoea sp. MT58)
MKKLVVLISGNGSNLQSILDACESGQIHGSVAAVFSNRAAAYGLTRAQQAGIPAHALAAS
DFADREAFDRQLITEIDAYRPDLIVLAGYMRILSSAFVAHFHNRLLNIHPSLLPKYPGLH
THRQALENGDSEHGTSVHFVTDELDGGPVILQAKVPVFPGDSEAEITERVQHQEHAIYPL
VISWFVEGRLEMRDGKAWLDGEPLPPQGYAND