Protein Info for IAI47_05165 in Pantoea sp. MT58

Annotation: phosphate ABC transporter permease PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 295 to 321 (27 residues), see Phobius details amino acids 333 to 361 (29 residues), see Phobius details amino acids 384 to 406 (23 residues), see Phobius details amino acids 428 to 452 (25 residues), see Phobius details amino acids 509 to 531 (23 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 276 to 536 (261 residues), 241.6 bits, see alignment E=4.4e-76 PF00528: BPD_transp_1" amino acids 312 to 536 (225 residues), 50 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 96% identity to pva:Pvag_2256)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (544 amino acids)

>IAI47_05165 phosphate ABC transporter permease PstA (Pantoea sp. MT58)
MKAMRQNDRWRWLTAGAVAVCLLAFTLLIGLLAWQGVRAFWPQRVDLYTFSQPEGGETRL
LGETLEHQRRFPAPADEQGNSGGQVNRYLIKTGNRDWDAPDFRVVYSRTAAKVSQPAEIM
VLQRRSHGQAYGWFVGLREDNEELTAQDPDALLNQRLGQVQMLVRQANQIRRVGMARINS
QREELDEQAATNRAAGHFDLQAESEYQANQAALQRRFNQLSETLASLQLQSQRDVLVLRD
VQGTEHAIPLTEIVDSWKPNAMTLTGKTGHFLHQLWRFVSDTPAEGESESGAFPAIFGTV
LMVLLMSVVVMPLGVIAAIWLHEYAGRNALTRLVRIAVVNLAGVPSIVYGVFGLGFFVWL
VGGTLDQLFFASALPNPTFGTPGLLWASLTLALLTLPVVIVATEEGLSRIPNSLRQGSLA
LGATQAETLWNVVLPMAVPAMLTGLILAVARAAGETAPLMLVGVVKMVPELPVDAVFPYL
HLDRKFMHLGFQIYDLAFQSPNIEADRPLVFATALLLVLIILSLNLLAMGLRHRLRERYR
LMTQ