Protein Info for IAI47_05145 in Pantoea sp. MT58

Annotation: tellurite resistance methyltransferase TehB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF03848: TehB" amino acids 10 to 198 (189 residues), 267.5 bits, see alignment E=1.9e-83 TIGR00477: tellurite resistance protein TehB" amino acids 10 to 201 (192 residues), 255.1 bits, see alignment E=2.8e-80 PF05175: MTS" amino acids 28 to 106 (79 residues), 28 bits, see alignment E=5.6e-10 PF13489: Methyltransf_23" amino acids 33 to 181 (149 residues), 30.8 bits, see alignment E=8.3e-11 PF13847: Methyltransf_31" amino acids 38 to 123 (86 residues), 29.1 bits, see alignment E=2.8e-10 PF08242: Methyltransf_12" amino acids 40 to 133 (94 residues), 31.2 bits, see alignment E=1.1e-10 PF08241: Methyltransf_11" amino acids 40 to 133 (94 residues), 34.5 bits, see alignment E=9.4e-12 PF13649: Methyltransf_25" amino acids 40 to 133 (94 residues), 48.8 bits, see alignment E=3.4e-16

Best Hits

Swiss-Prot: 57% identical to TEHB_ECOLI: Tellurite methyltransferase (tehB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_2260)

MetaCyc: 57% identical to tellurite methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6576 [EC: 2.1.1.265]

Predicted SEED Role

"Tellurite resistance protein TehB"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.265

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>IAI47_05145 tellurite resistance methyltransferase TehB (Pantoea sp. MT58)
MTQPTAPLSGENYFADTYGLTPPHSEVVAALPQLNVGKALDLGCGVGRNTLFLNQHGFDV
TAWDHNPQSLARLQEIIAQENLQGIHTEQHDLNNTRFNGGFNVVLSTVVMMFLQPQTIPQ
LIADMQACTVRDGFNLIVAAMNTDDMPCPADFSFAFKSGELSHYYRNWHIVKYNEHPGQL
HRKDENGNRITCRFATLLAQKASY