Protein Info for IAI47_05135 in Pantoea sp. MT58

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 312 to 330 (19 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 414 to 439 (26 residues), see Phobius details amino acids 451 to 475 (25 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 49 to 474 (426 residues), 241.2 bits, see alignment E=9.5e-76 PF03448: MgtE_N" amino acids 59 to 153 (95 residues), 70.5 bits, see alignment E=2.4e-23 PF00571: CBS" amino acids 162 to 218 (57 residues), 16.8 bits, see alignment 1.1e-06 amino acids 226 to 280 (55 residues), 35.6 bits, see alignment 1.4e-12 PF01769: MgtE" amino acids 346 to 469 (124 residues), 111.6 bits, see alignment E=4.5e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 98% identity to pva:Pvag_2262)

Predicted SEED Role

"Magnesium transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>IAI47_05135 magnesium transporter (Pantoea sp. MT58)
MSASQSQRLSEIRHRILTLLLNEHDLVDSLLEKSGDLNPEQQRENAAQRDALEQDIQQLH
AADLADILEALPEEERQALWRLVPNERRGHVLVEASETVWASLTEEMSDRDILRAIQPLD
IDDQVWLAQYLPRDLTGRLLATVEPALRARMLDMVQLDRDRVGRVMDFNILTVRDDVTLA
TVQRFLRKRKSMPGGTDKLFITNKDNQLLGELLLTDILLNKPKTLVSDVMNARPTTFQLN
DKAEDAASAFERYNLISAAVTDAKGKLIGRVTIEDIVDLVNAENESNIRKMGGISQEEDV
FAPVRKSVRKRWAWLAINLCTAFVASRVIGLFEGTISQIVALATLMPIVAGIGGNTGNQT
ITMIVRALALHQVEPGNFSFLIVRELGVALINGLFWGGIMGGITWLMYDNMALGGVMMLA
MALNLLLAALMGVLVPLVMTKMKRDPAVGSSVLITALTDTGGFFIFLGLATIFLLPH