Protein Info for IAI47_05100 in Pantoea sp. MT58

Annotation: exodeoxyribonuclease VII large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF13742: tRNA_anti_2" amino acids 10 to 102 (93 residues), 113.1 bits, see alignment E=9.1e-37 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 11 to 356 (346 residues), 454.1 bits, see alignment E=2.3e-140 PF01336: tRNA_anti-codon" amino acids 30 to 104 (75 residues), 44.3 bits, see alignment E=2e-15 PF02601: Exonuc_VII_L" amino acids 126 to 440 (315 residues), 377.2 bits, see alignment E=1.2e-116

Best Hits

Swiss-Prot: 78% identical to EX7L_ERWT9: Exodeoxyribonuclease 7 large subunit (xseA) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 96% identity to pva:Pvag_2270)

MetaCyc: 74% identical to exodeoxyribonuclease VII subunit XseA (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>IAI47_05100 exodeoxyribonuclease VII large subunit (Pantoea sp. MT58)
MSLPPIANIFTVSRLNTTVRQLLEKEMGLVWISAEISNFTQPASGHWYFTLKDDGAQVRC
AMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQLIAESMHPAGEGLLQQQFELLKAK
LATEGLFDPQHKQPLPEPARQVGVITSSTGAALHDVLRVLHRRDPSLPVVIYPTVVQGVD
APAAIVRAIEIANLRNECDVLIVGRGGGSLEDLWSFNDERVARAIFASRIPIVSAVGHET
DVTIADFVADLRAPTPSAAAEIVSRNQLELLRQLQSQQQRLEMAMDYYLARQQRLYTRLE
HRLQQQHPQLRLARQQTALFRLQQRLGEAMETRLRHATRQQDRLSQRLNAQQPQQRLFEA
QKQLQNWHYRLQQSITQQLNSNRQHFGQLVAQLEGVSPLATLARGFSVTTDTTGQVVKKT
AQLQSGDLLRTRLDDGWVESQVTQLLPEKKRRRKTAS