Protein Info for IAI47_05095 in Pantoea sp. MT58

Annotation: peptidase M4 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF16485: PLN_propep" amino acids 3 to 41 (39 residues), 58.8 bits, see alignment 5.3e-20 PF01447: Peptidase_M4" amino acids 58 to 166 (109 residues), 106.3 bits, see alignment E=3e-34 PF02868: Peptidase_M4_C" amino acids 169 to 336 (168 residues), 167.5 bits, see alignment E=3.8e-53

Best Hits

Swiss-Prot: 67% identical to PRT1_PECCC: Extracellular metalloprotease (prt1) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_2271)

Predicted SEED Role

"Extracellular metalloprotease precursor (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>IAI47_05095 peptidase M4 family protein (Pantoea sp. MT58)
MAYSVIPPYILRKIIAHGSGHQQEQARRTLTHVQHLMAEHWQKPTGVKTAAGGHVDREIY
DAQSQQTLPGKLIRQEGQPGNDDVAAEEAWDYLGVTYDFFWQAYQRNSLDNQGLKLLGTV
HYGEKYQNAFWNGQQMVFGDGDGEIFNRFTIAIDVVAHELAHGVTENEAGLIYFEQSGAL
NESLSDVFGSLVKQFSKKQRADEADWIIGEGLLAKGINGRGLRSMSEPGTAYDDPMLGKD
PQPAHMDHFVKTREDNGGVHINSGIPNRAFYLAAKALGGYAWEQAGYAWYDTVCDDELPQ
NADFKTFARFTVEHGKKRFDASVSNAIEQAWKEVGVL