Protein Info for IAI47_04980 in Pantoea sp. MT58

Annotation: nickel/cobalt transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details PF03824: NicO" amino acids 68 to 190 (123 residues), 73.9 bits, see alignment E=7.2e-25 amino acids 195 to 312 (118 residues), 42.9 bits, see alignment E=2.1e-15

Best Hits

KEGG orthology group: None (inferred from 74% identity to pam:PANA_2873)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>IAI47_04980 nickel/cobalt transporter (Pantoea sp. MT58)
MSIISTPSRATRLWPLWLIAGLFSGGALLVWLYWSQILLQSVLWQKDLHRQMTQLLQQVA
EQPHQAGISLVIFSLIYGVLHALGPGHGKVVIATFLATHPSRVRTSIRLTLLASLLQGSV
AIVLVTVMLVLLKTSSRQLHLSSFWLEKGSYLLVIGLGVMIGYRALRALWLALRPRPAPV
FRAFQPQHQHDEHCGCGHAHLPTPQQMNGNVSWKTQMLVVVSMGLRPCSGAIMMLLFAKV
IGVYGWGILSAAVMALGTALTISAIGLLVQQARSVAQRLAQPGAGIMRLLIPILALTGSL
ILIVVGIALWQSARLTLGGGIRPF